PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462875385
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family B3
Protein Properties Length: 441aa    MW: 49952.7 Da    PI: 10.0636
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462875385genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B357.32.8e-1879166196
                EEEE-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
         B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                ffkv+ p+ +++  rl +p +f  ++ +++++++  ++l+ +sg++W+  l  + + ++  +t+GWkeFv ++ L++g f+vF++dg+sef+ v  v
  462875385  79 FFKVFFPEQSGE--RLKIPQPFW-KYlKEEPTRP--ISLKGPSGNTWQAML--TSGEEGLGFTQGWKEFVGDHSLQQGHFLVFTYDGHSEFSVV--V 166
                899998877776..59******9.5547777776..***************..999999****************************9999443..3 PP

2B352.77.8e-17336427398
                EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
         B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                +v++ s+v     + +p +fa+e   + ++ k++tl d++g+ Wev++ y   ++   +++GW +F+  n+L+  D++vF+l +  e + +v+++r
  462875385 336 QVMMESYVYVGFFMNIPCEFAREWL-P-RTCKKMTLWDPQGKPWEVQYVYYSERSVAAFSGGWGKFAVGNNLEKFDVCVFELLK--ENNIKVHIYR 427
                68999****************9995.3.4568****************9988888899***********************886..4455888876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd100171.40E-1777168No hitNo description
Gene3DG3DSA:2.40.330.103.3E-2277171IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.6277170IPR003340B3 DNA binding domain
SuperFamilySSF1019363.34E-2177171IPR015300DNA-binding pseudobarrel domain
PfamPF023624.3E-1679166IPR003340B3 DNA binding domain
SMARTSM010193.0E-1579171IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.6E-25325427IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.51E-23327427IPR015300DNA-binding pseudobarrel domain
CDDcd100178.98E-25332427No hitNo description
PROSITE profilePS5086313.338334429IPR003340B3 DNA binding domain
SMARTSM010191.6E-13334429IPR003340B3 DNA binding domain
PfamPF023623.5E-15336427IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 441 aa     Download sequence    Send to blast
MARENQQQQG ISSAAAAAKE RSMRKGKESG MEKQKEKGAE ERMEKGTEKG KYNGREGRKE  60
QKGRGEAKKR DAVGAGRHFF KVFFPEQSGE RLKIPQPFWK YLKEEPTRPI SLKGPSGNTW  120
QAMLTSGEEG LGFTQGWKEF VGDHSLQQGH FLVFTYDGHS EFSVVVFCKS GVEDESALDA  180
QPSKERVVKA EEEKGAQDTD VAGASEREAS ALPSVEDNGK TRKRVRQGMV NSSVPKRQCV  240
QKKPENRRPE AFIDTSKAGS TVPDSNKDLS CMLDEYSSFN KSGTRLKDVP RVGKAVSKKS  300
RQPVVISQRR RITEEEKGHA LKRAKEFKSK NPFTLQVMME SYVYVGFFMN IPCEFAREWL  360
PRTCKKMTLW DPQGKPWEVQ YVYYSERSVA AFSGGWGKFA VGNNLEKFDV CVFELLKENN  420
IKVHIYRVVP DVTPLLRNRS M
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A7e-1530742822142B3 domain-containing transcription factor VRN
4i1k_B7e-1530742822142B3 domain-containing transcription factor VRN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978926.11e-160PREDICTED: B3 domain-containing protein Os11g0197600-like
SwissprotQ2R9D21e-129Y1176_ORYSJ; B3 domain-containing protein Os11g0197600
TrEMBLA0A0A9DCS31e-169A0A0A9DCS3_ARUDO; Uncharacterized protein
STRINGSi027380m1e-150(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44613766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.19e-33B3 family protein